New Batch In Stock! Explore Our Highly Purified Peptides.

Your Research, Our Priority. 24/7 Ordering Now Available.

For Purity & Precision in Research. Peptides >99% Pure.

Your Research, Our Priority. 24/7 Ordering Now Available.

Peptide Online Store
  • Home
  • Shop
  • Our Company
  • Contact us
  • FAQs
  • Shipping & Payments
  • Refunds & Returns
  • Blog
Login / Register
0 items / $0.00
Menu
Peptide Online Store
Login / Register
Sign inCreate an Account

Lost your password?
0 items / $0.00
Select category
  • Select category
  • Peptides
  • Research Chemicals
    • Amphetamines
      • 4-FMA
    • Benzodiazepines
      • Etizolam
    • Benzofuran
      • 6-APB (Benzofury)
    • Cathinonen
      • 3-MMC
    • Lysergamides
      • 1P-LSD
    • Phenethylamines
      • 2C-B-FLY
Hot
Home Peptides Buy Vasoactive Intestinal Peptide (VIP) – 6mg
Buy Vilon 20mg (Bioregulator)
Buy Vilon 20mg (Bioregulator) $65.00
Back to products
2-MMC Powder
2-MMC Powder $9.65

Buy Vasoactive Intestinal Peptide (VIP) – 6mg

$75.00

VIP 6mg – A powerful research peptide with potent anti-inflammatory and antifibrotic properties, extensively studied for its role in neurodegenerative diseases, pulmonary fibrosis, inflammatory bowel disease, and cardiac fibrosis.

 

 

Add $200.00 to cart and get free shipping!
Note: The product image is for illustrative purposes only and may not be a true representation of the actual product. Please refer to the product description for accurate details.
Category: Peptides
  • Description
  • Reviews (0)
Description

Buy Vasoactive Intestinal Peptide (VIP) for Neuroprotective and Cardiovascular Research with Discreet Worldwide Shipping

Vasoactive Intestinal Peptide (VIP) 6 mg is a high-purity research peptide known for its broad biological significance across neuroprotective, gastrointestinal, and immune-modulating research applications. At Peptide Online Store, we supply only research-grade VIP peptides manufactured to ≥99% purity, ensuring reliability, consistency, and performance in scientific investigations.


What is Vasoactive Intestinal Peptide (VIP)?

Vasoactive Intestinal Peptide (VIP) is a 28-amino-acid neuropeptide belonging to the secretin/glucagon peptide family. It was first isolated from porcine intestine and has since been identified as a multifunctional signaling molecule involved in smooth muscle relaxation, vasodilation, neurotransmission, and immunoregulation.

In research, VIP is studied for its potential roles in circadian rhythm regulation, gastrointestinal motility, anti-inflammatory signaling, and neuroprotection.


How Does Vasoactive Intestinal Peptide (VIP) Work in the Body?

VIP binds primarily to VPAC1 and VPAC2 receptors, which are G-protein-coupled receptors distributed in the central nervous system, lungs, liver, and immune tissues.

Upon binding, VIP activates adenylate cyclase, increasing cyclic AMP (cAMP) production, leading to:

  • Relaxation of smooth muscles in blood vessels and airways

  • Modulation of immune cell activity

  • Neuroprotective effects via reduced inflammation and oxidative stress

  • Regulation of circadian rhythm through the suprachiasmatic nucleus

These mechanisms make VIP a valuable subject in neurological, cardiovascular, and immunological research.


Key Benefits of Vasoactive Intestinal Peptide (VIP)

  • Promotes vasodilation and improved microcirculation in experimental models

  • Supports neuroprotective pathways and neuron survival

  • Demonstrates anti-inflammatory properties in immune cell research

  • Aids in respiratory and gastrointestinal studies involving smooth-muscle regulation

  • Explored for circadian rhythm and sleep regulation mechanisms

(For laboratory and in-vitro research purposes only.)


Product Details and Purity

  • Product Name: Vasoactive Intestinal Peptide (VIP)

  • Molecular Formula: C147H237N43O42S

  • Molecular Weight: ~3325 Da

  • Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂

  • Purity: ≥99% (HPLC and Mass Spectrometry verified)

  • Form: Lyophilized powder

  • Quantity: 6 mg per vial

  • Storage: Store at −20 °C, protected from light and moisture

  • Solubility: Soluble in sterile water or buffer


Dosage & Usage Guidelines

  • Reconstitute with bacteriostatic water or sterile saline before use.

  • Typical research concentrations range from 10 µg/mL to 100 µg/mL, depending on the experimental design.

  • Avoid repeated freeze-thaw cycles.

  • Label clearly as “For Research Use Only — Not for Human Consumption.”


Safety, Side Effects & Precautions

  • Handle using protective gloves, mask, and lab coat.

  • Avoid direct contact or inhalation.

  • Dispose of unused peptide following institutional biosafety protocols.

  • No human or veterinary applications are approved — research use only.


Quality Assurance & Testing

Every batch of VIP peptide undergoes rigorous HPLC and Mass Spectrometry testing to confirm purity and identity.
Manufactured in ISO-certified, GMP-compliant facilities, our peptides meet the highest international standards for research-grade materials.

Each vial includes a Certificate of Analysis (COA) verifying peptide composition and batch traceability.


Commitment to Quality and Compliance

Peptide Online Store ensures:

  • GMP manufacturing standards

  • Ethical and traceable sourcing

  • Strict batch-to-batch consistency

  • Compliance with international peptide research regulations

Our commitment guarantees safe, consistent, and reliable peptides for scientific exploration.


Potential Applications (For Research Use Only)

  • Neuroprotection and CNS signaling studies

  • Cardiovascular physiology and vascular tone regulation

  • Pulmonary function and asthma models

  • Gastrointestinal motility and secretion research

  • Circadian rhythm and endocrine system research

(Not intended for human or animal therapeutic use.)


Why Choose Peptide Online Store for Vasoactive Intestinal Peptide (VIP)?

  • ≥99% HPLC-verified purity

  • Discreet global shipping in temperature-controlled packaging

  • Competitive pricing for bulk and single-vial orders

  • Secure online ordering and multiple payment options

  • Exceptional customer support with scientific knowledge

Peptide Online Store is trusted by researchers worldwide for its purity, transparency, and reliability.


Shipping & Delivery Information

  • Worldwide delivery via trusted carriers

  • Orders processed within 24–48 hours

  • Discreet and temperature-controlled packaging

  • Real-time tracking updates for all shipments

  • Express delivery options available


How to Order Online

  1. Navigate to PeptideOnlineStore.com.

  2. Search for “Vasoactive Intestinal Peptide (VIP).”

  3. Select quantity and add to cart.

  4. Proceed to secure checkout.

  5. Receive email confirmation and shipment tracking.

All transactions are SSL-encrypted for data protection and payment security.


Frequently Asked Questions (FAQ)

Q1: What is the purity of your VIP peptide?
A: Each batch is HPLC-verified to ensure ≥99% purity.

Q2: Can VIP be used for clinical trials?
A: VIP is for research use only, not approved for human or clinical use.

Q3: How should VIP be stored?
A: Store at −20 °C in a dry, dark environment; reconstituted solutions should be refrigerated.

Q4: Do you provide a Certificate of Analysis (COA)?
A: Yes, every order includes a COA for verification.

Q5: How long does shipping take?
A: International orders typically arrive within 5–10 business days, depending on destination.


Related Products to Vasoactive Intestinal Peptide (VIP)

  • Pituitary Adenylate Cyclase-Activating Polypeptide (PACAP)

  • Growth Hormone-Releasing Peptide-6 (GHRP-6)

  • BPC-157

  • Thymosin Beta-4 (TB-500)

Explore these complementary peptides for advanced physiological and neurological studies.


Final Thoughts

Vasoactive Intestinal Peptide (VIP) remains an essential research peptide for exploring neuroprotective, cardiovascular, and immunomodulatory pathways. At Peptide Online Store, our VIP 6 mg vials deliver exceptional purity, consistency, and reliability, ensuring optimal results for your laboratory investigations.

Order today to experience fast, discreet, and globally trusted peptide delivery.

Reviews (0)

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

Related products

Quick view

Buy CJC 1295 DAC (2mg x 10) Hexarelin (2mg x 10)

Peptides
$485.00
Add to cart
Quick view

Buy CJC 1295 DAC (2mg x 10) Ipamorelin (2mg x 10)

Peptides
$485.00
Add to cart
Quick view

Buy CJC-1295, Ipamorelin 10mg (No DAC) (Peptide Blend)

Peptides
$95.00
Add to cart
Quick view

Buy AHK (Tripeptide-3) 200mg (Topical)

Peptides
$200.00
Add to cart
Quick view

Buy Cerebrolysin 215mg/ml (10ml)

Peptides
$120.00
Add to cart
-10%
Quick view

Buy Cortagen 20mg (Bioregulator)

Peptides
$65.00 Original price was: $65.00.$58.50Current price is: $58.50.
Add to cart
Hot
Quick view

Buy AICAR 50mg

Peptides
$60.00
Add to cart
Quick view

Buy Cardiogen 20mg (Bioregulator)

Peptides
$65.00
Add to cart

Peptide Online Store

We deliver top-quality peptides and proteins, supporting global research with excellence and innovation.
  • service@Peptideonlinestore.com
  • Service Area: Worldwide
  • Ships From: USA & Europe

Recent Posts
  • Buy Peptides for Weight Loss: Exploring the Science and Benefits
    Peptides for Weight Loss: Exploring the Science and Benefits
    January 15, 2025 No Comments
Best Sellers
  • 5-MeO-DMT Powder (Hydrochloride) 5-MeO-DMT Powder (Hydrochloride) $0.17
  • Bromonordiazepam Blister - 10x 2.5mg Bromonordiazepam Blister - 10x 2.5mg $15.84
USEFUL LINKS
  • FAQs
  • Privacy Policy
  • Terms of use
  • Shipping & Payments
  • Refunds & Returns
New Product
  • 5-MeO-DMT Powder (Hydrochloride) 5-MeO-DMT Powder (Hydrochloride) $0.17

© 2026 Peptide Online Store. All rights reserved

  • Home
  • Shop
  • Our Company
  • Contact us
  • FAQs
  • Shipping & Payments
  • Refunds & Returns
  • Blog
  • Login / Register
Shopping cart
close