Buy Vasoactive Intestinal Peptide (VIP) for Neuroprotective and Cardiovascular Research with Discreet Worldwide Shipping
Vasoactive Intestinal Peptide (VIP) 6 mg is a high-purity research peptide known for its broad biological significance across neuroprotective, gastrointestinal, and immune-modulating research applications. At Peptide Online Store, we supply only research-grade VIP peptides manufactured to ≥99% purity, ensuring reliability, consistency, and performance in scientific investigations.
What is Vasoactive Intestinal Peptide (VIP)?
Vasoactive Intestinal Peptide (VIP) is a 28-amino-acid neuropeptide belonging to the secretin/glucagon peptide family. It was first isolated from porcine intestine and has since been identified as a multifunctional signaling molecule involved in smooth muscle relaxation, vasodilation, neurotransmission, and immunoregulation.
In research, VIP is studied for its potential roles in circadian rhythm regulation, gastrointestinal motility, anti-inflammatory signaling, and neuroprotection.
How Does Vasoactive Intestinal Peptide (VIP) Work in the Body?
VIP binds primarily to VPAC1 and VPAC2 receptors, which are G-protein-coupled receptors distributed in the central nervous system, lungs, liver, and immune tissues.
Upon binding, VIP activates adenylate cyclase, increasing cyclic AMP (cAMP) production, leading to:
Relaxation of smooth muscles in blood vessels and airways
Modulation of immune cell activity
Neuroprotective effects via reduced inflammation and oxidative stress
Regulation of circadian rhythm through the suprachiasmatic nucleus
These mechanisms make VIP a valuable subject in neurological, cardiovascular, and immunological research.
Key Benefits of Vasoactive Intestinal Peptide (VIP)
Promotes vasodilation and improved microcirculation in experimental models
Supports neuroprotective pathways and neuron survival
Demonstrates anti-inflammatory properties in immune cell research
Aids in respiratory and gastrointestinal studies involving smooth-muscle regulation
Explored for circadian rhythm and sleep regulation mechanisms
(For laboratory and in-vitro research purposes only.)
Product Details and Purity
Product Name: Vasoactive Intestinal Peptide (VIP)
Molecular Formula: C147H237N43O42S
Molecular Weight: ~3325 Da
Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
Purity: ≥99% (HPLC and Mass Spectrometry verified)
Form: Lyophilized powder
Quantity: 6 mg per vial
Storage: Store at −20 °C, protected from light and moisture
Solubility: Soluble in sterile water or buffer
Dosage & Usage Guidelines
Reconstitute with bacteriostatic water or sterile saline before use.
Typical research concentrations range from 10 µg/mL to 100 µg/mL, depending on the experimental design.
Avoid repeated freeze-thaw cycles.
Label clearly as “For Research Use Only — Not for Human Consumption.”
Safety, Side Effects & Precautions
Handle using protective gloves, mask, and lab coat.
Avoid direct contact or inhalation.
Dispose of unused peptide following institutional biosafety protocols.
No human or veterinary applications are approved — research use only.
Quality Assurance & Testing
Every batch of VIP peptide undergoes rigorous HPLC and Mass Spectrometry testing to confirm purity and identity.
Manufactured in ISO-certified, GMP-compliant facilities, our peptides meet the highest international standards for research-grade materials.
Each vial includes a Certificate of Analysis (COA) verifying peptide composition and batch traceability.
Commitment to Quality and Compliance
Peptide Online Store ensures:
GMP manufacturing standards
Ethical and traceable sourcing
Strict batch-to-batch consistency
Compliance with international peptide research regulations
Our commitment guarantees safe, consistent, and reliable peptides for scientific exploration.
Potential Applications (For Research Use Only)
Neuroprotection and CNS signaling studies
Cardiovascular physiology and vascular tone regulation
Pulmonary function and asthma models
Gastrointestinal motility and secretion research
Circadian rhythm and endocrine system research
(Not intended for human or animal therapeutic use.)
Why Choose Peptide Online Store for Vasoactive Intestinal Peptide (VIP)?
≥99% HPLC-verified purity
Discreet global shipping in temperature-controlled packaging
Competitive pricing for bulk and single-vial orders
Secure online ordering and multiple payment options
Exceptional customer support with scientific knowledge
Peptide Online Store is trusted by researchers worldwide for its purity, transparency, and reliability.
Shipping & Delivery Information
Worldwide delivery via trusted carriers
Orders processed within 24–48 hours
Discreet and temperature-controlled packaging
Real-time tracking updates for all shipments
Express delivery options available
How to Order Online
Navigate to PeptideOnlineStore.com.
Search for “Vasoactive Intestinal Peptide (VIP).”
Select quantity and add to cart.
Proceed to secure checkout.
Receive email confirmation and shipment tracking.
All transactions are SSL-encrypted for data protection and payment security.
Frequently Asked Questions (FAQ)
Q1: What is the purity of your VIP peptide?
A: Each batch is HPLC-verified to ensure ≥99% purity.
Q2: Can VIP be used for clinical trials?
A: VIP is for research use only, not approved for human or clinical use.
Q3: How should VIP be stored?
A: Store at −20 °C in a dry, dark environment; reconstituted solutions should be refrigerated.
Q4: Do you provide a Certificate of Analysis (COA)?
A: Yes, every order includes a COA for verification.
Q5: How long does shipping take?
A: International orders typically arrive within 5–10 business days, depending on destination.
Related Products to Vasoactive Intestinal Peptide (VIP)
Pituitary Adenylate Cyclase-Activating Polypeptide (PACAP)
Growth Hormone-Releasing Peptide-6 (GHRP-6)
BPC-157
Thymosin Beta-4 (TB-500)
Explore these complementary peptides for advanced physiological and neurological studies.
Final Thoughts
Vasoactive Intestinal Peptide (VIP) remains an essential research peptide for exploring neuroprotective, cardiovascular, and immunomodulatory pathways. At Peptide Online Store, our VIP 6 mg vials deliver exceptional purity, consistency, and reliability, ensuring optimal results for your laboratory investigations.
Order today to experience fast, discreet, and globally trusted peptide delivery.

Reviews
There are no reviews yet.